Class a: All alpha proteins [46456] (171 folds) |
Fold a.46: Methionine synthase domain-like [47643] (2 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (1 family) |
Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins) |
Protein Pyrimidine nucleoside phosphorylase [47652] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [47653] (1 PDB entry) |
Domain d1brwb1: 1brw B:1001-1070 [17765] Other proteins in same PDB: d1brwa2, d1brwa3, d1brwb2, d1brwb3 complexed with ca, mes, po4, ura |
PDB Entry: 1brw (more details), 2.1 Å
SCOP Domain Sequences for d1brwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1brwb1 a.46.2.1 (B:1001-1070) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus} mrmvdliakkrdgkaltkeeiewivrgytngdipdyqmsalamaiyfrgmteeetaaltm amvqsgemld
Timeline for d1brwb1: