SCOP 1.65: Domain d1brwb1: 1brw B:1001-1070

Lineage for d1brwb1 (1brw B:1001-1070)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (2 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (1 family)

5. Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)

6. Protein Pyrimidine nucleoside phosphorylase [47652] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [47653] (1 PDB entry)

8. Domain d1brwb1: 1brw B:1001-1070 [17765]
   Other proteins in same PDB: d1brwa2, d1brwa3, d1brwb2, d1brwb3
   complexed with ca, mes, po4, ura

Details for d1brwb1

PDB Entry: 1brw, 2.1 Å

PDB Description: the crystal structure of pyrimidine nucleoside phosphorylase in a closed conformation

SCOP Domain Sequences for d1brwb1:

Sequence; same for both SEQRES and ATOM records:

>d1brwb1 a.46.2.1 (B:1001-1070) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus}
mrmvdliakkrdgkaltkeeiewivrgytngdipdyqmsalamaiyfrgmteeetaaltm
amvqsgemld

Timeline for d1brwb1:

• d1brwb1 first appeared (with stable ids) in SCOP 1.55
  
• d1brwb1 appears in SCOP 1.63
  
• d1brwb1 appears in SCOP 1.67
  
• d1brwb1 appears in the current release, SCOPe 2.08