SCOP 1.73: Domain d1azya1: 1azy A:1-70

Lineage for d1azya1 (1azy A:1-70)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (1 family)

5. Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)

6. Protein Thymidine phosphorylase [47650] (2 species)

7. Species Escherichia coli [TaxId:562] [47651] (4 PDB entries)

8. Domain d1azya1: 1azy A:1-70 [17761]
   Other proteins in same PDB: d1azya2, d1azya3, d1azyb2, d1azyb3

Details for d1azya1

PDB Entry: 1azy, 3 Å

PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase

PDB Compounds: (A:) thymidine phosphorylase

SCOP Domain Sequences for d1azya1:

Sequence; same for both SEQRES and ATOM records:

>d1azya1 a.46.2.1 (A:1-70) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
lflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
mamrdsgtvl

Timeline for d1azya1:

• d1azya1 first appeared (with stable ids) in SCOP 1.55
  
• d1azya1 appears in SCOP 1.71
  
• d1azya1 appears in SCOP 1.75
  
• d1azya1 appears in the current release, SCOPe 2.08