Lineage for d1azya1 (1azy A:1-70)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3964Fold a.46: Methionine synthase domain-like [47643] (2 superfamilies)
  4. 3971Superfamily a.46.2: Pyrimidine nucleoside phosphorylase N-terminal domain [47648] (1 family) (S)
  5. 3972Family a.46.2.1: Pyrimidine nucleoside phosphorylase N-terminal domain [47649] (2 proteins)
  6. 3977Protein Thymidine phosphorylase [47650] (1 species)
  7. 3978Species Escherichia coli [TaxId:562] [47651] (4 PDB entries)
  8. 3981Domain d1azya1: 1azy A:1-70 [17761]
    Other proteins in same PDB: d1azya2, d1azya3, d1azyb2, d1azyb3

Details for d1azya1

PDB Entry: 1azy (more details), 3 Å

PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase
PDB Compounds: (A:)

SCOP Domain Sequences for d1azya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azya1 a.46.2.1 (A:1-70) Thymidine phosphorylase {Escherichia coli}
lflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
mamrdsgtvl

SCOP Domain Coordinates for d1azya1:

Click to download the PDB-style file with coordinates for d1azya1.
(The format of our PDB-style files is described here.)

Timeline for d1azya1: