| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) ![]() automatically mapped to Pfam PF02885 |
| Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins) |
| Protein Thymidine phosphorylase [47650] (2 species) |
| Species Escherichia coli [TaxId:562] [47651] (7 PDB entries) |
| Domain d1azya1: 1azy A:2-70 [17761] Other proteins in same PDB: d1azya2, d1azya3, d1azya4, d1azyb2, d1azyb3, d1azyb4 |
PDB Entry: 1azy (more details), 3 Å
SCOPe Domain Sequences for d1azya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1azya1 a.46.2.1 (A:2-70) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
flaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervsltm
amrdsgtvl
Timeline for d1azya1:
View in 3DDomains from other chains: (mouse over for more information) d1azyb1, d1azyb2, d1azyb3, d1azyb4 |