Lineage for d1azya1 (1azy A:2-70)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714352Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2714363Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2714364Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 2714411Protein Thymidine phosphorylase [47650] (2 species)
  7. 2714412Species Escherichia coli [TaxId:562] [47651] (7 PDB entries)
  8. 2714418Domain d1azya1: 1azy A:2-70 [17761]
    Other proteins in same PDB: d1azya2, d1azya3, d1azya4, d1azyb2, d1azyb3, d1azyb4

Details for d1azya1

PDB Entry: 1azy (more details), 3 Å

PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d1azya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azya1 a.46.2.1 (A:2-70) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
flaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervsltm
amrdsgtvl

SCOPe Domain Coordinates for d1azya1:

Click to download the PDB-style file with coordinates for d1azya1.
(The format of our PDB-style files is described here.)

Timeline for d1azya1: