Lineage for d3hhib_ (3hhi B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2534811Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2534812Protein automated matches [190230] (23 species)
    not a true protein
  7. 2535008Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [189337] (2 PDB entries)
  8. 2535010Domain d3hhib_: 3hhi B: [177577]
    automated match to d1pbha_
    complexed with 074, gol, li, mg, trs

Details for d3hhib_

PDB Entry: 3hhi (more details), 1.6 Å

PDB Description: crystal structure of cathepsin b from t. brucei in complex with ca074
PDB Compounds: (B:) Cathepsin B-like cysteine protease

SCOPe Domain Sequences for d3hhib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hhib_ d.3.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
silpkrrfteeearaplpssfdsaeawpncptipqiadqsacgscwavaaasamsdrfct
mggvqdvhisagdllaccsdcgdgcnggdpdrawayfsstglvsdycqpypfphcshhsk
skngyppcsqfnfdtpkcdytcddptipvvnyrswtsyalqgeddymrelffrgpfevaf
dvyedfiaynsgvyhhvsgqylgghavrlvgwgtsngvpywkianswntewgmdgyflir
rgssecgiedggsagiplap

SCOPe Domain Coordinates for d3hhib_:

Click to download the PDB-style file with coordinates for d3hhib_.
(The format of our PDB-style files is described here.)

Timeline for d3hhib_: