![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
![]() | Protein automated matches [190230] (23 species) not a true protein |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [189337] (2 PDB entries) |
![]() | Domain d3hhib_: 3hhi B: [177577] automated match to d1pbha_ complexed with 074, gol, li, mg, trs |
PDB Entry: 3hhi (more details), 1.6 Å
SCOPe Domain Sequences for d3hhib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hhib_ d.3.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} silpkrrfteeearaplpssfdsaeawpncptipqiadqsacgscwavaaasamsdrfct mggvqdvhisagdllaccsdcgdgcnggdpdrawayfsstglvsdycqpypfphcshhsk skngyppcsqfnfdtpkcdytcddptipvvnyrswtsyalqgeddymrelffrgpfevaf dvyedfiaynsgvyhhvsgqylgghavrlvgwgtsngvpywkianswntewgmdgyflir rgssecgiedggsagiplap
Timeline for d3hhib_: