![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis |
![]() | Superfamily d.126.1: Pentein [55909] (8 families) ![]() |
![]() | Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins) Pfam PF04371; functionally related to the amidinotransferase, similar active site |
![]() | Protein automated matches [190353] (3 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187181] (3 PDB entries) |
![]() | Domain d3h7ka1: 3h7k A:2-376 [177306] Other proteins in same PDB: d3h7ka2 automated match to d1vkpa_ complexed with 1pe, cl, mg, na |
PDB Entry: 3h7k (more details), 1.84 Å
SCOPe Domain Sequences for d3h7ka1:
Sequence, based on SEQRES records: (download)
>d3h7ka1 d.126.1.6 (A:2-376) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} eesrespaehgyympaewdshaqtwigwperqdnwrhnalpaqrvfagvakaiskfepvt vcaspaqwenarkqlpedirvvemsmndswfrdsgptfivrkrpvklsslnrniagidwn fnawggandgcyndwshdllvsrkilaleriprfqhsmileggsihvdgegtclvteecl lnknrnphmskeqieeelkkylgvqsfiwlprglygdedtnghidnmccfarpgvvllsw tddetdpqyersvealsvlsnsidargrkiqviklyipeplymteeessgitqdgeaipr lagtrlaasyvnfyianggiiapqfgdpirdkeairvlsdtfphhsvvgienareivlag gnihxitqqqpaept
>d3h7ka1 d.126.1.6 (A:2-376) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} eesrespaehgyympaewdshaqtwigwperqdnwrhnalpaqrvfagvakaiskfepvt vcaspaqwenarkqlpedirvvemsmndswfrdsgptfivrkrniagidwnfnawggand gcyndwshdllvsrkilaleriprfqhsmileggsihvdgegtclvteecllnknrnphm skeqieeelkkylgvqsfiwlprglygdedtnghidnmccfarpgvvllswtddetdpqy ersvealsvlsnsidargrkiqviklyipeplymteeessgitqdgeaiprlagtrlaas yvnfyianggiiapqfgdpirdkeairvlsdtfphhsvvgienareivlaggnihxitqq qpaept
Timeline for d3h7ka1: