SCOPe 2.04: Domain d1bx9a1: 1bx9 A:86-210

Lineage for d1bx9a1 (1bx9 A:86-210)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class phi GST [81356] (3 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [47635] (2 PDB entries)

8. Domain d1bx9a1: 1bx9 A:86-210 [17729]
   Other proteins in same PDB: d1bx9a2

Details for d1bx9a1

PDB Entry: 1bx9, 2.6 Å

PDB Description: glutathione s-transferase in complex with herbicide

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1bx9a1:

Sequence; same for both SEQRES and ATOM records:

>d1bx9a1 a.45.1.1 (A:86-210) Class phi GST {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklakv
ldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrpa
sekvq

Timeline for d1bx9a1:

• d1bx9a1 first appeared (with stable ids) in SCOP 1.55
  
• d1bx9a1 appears in SCOPe 2.03
  
• d1bx9a1 appears in SCOPe 2.05
  
• d1bx9a1 appears in the current release, SCOPe 2.08