Lineage for d1bx9a1 (1bx9 A:86-210)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3883Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [47635] (2 PDB entries)
  8. 3886Domain d1bx9a1: 1bx9 A:86-210 [17729]
    Other proteins in same PDB: d1bx9a2

Details for d1bx9a1

PDB Entry: 1bx9 (more details), 2.6 Å

PDB Description: glutathione s-transferase in complex with herbicide

SCOP Domain Sequences for d1bx9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx9a1 a.45.1.1 (A:86-210) Glutathione S-transferase {Mouse-ear cress (Arabidopsis thaliana)}
qtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklakv
ldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrpa
sekvq

SCOP Domain Coordinates for d1bx9a1:

Click to download the PDB-style file with coordinates for d1bx9a1.
(The format of our PDB-style files is described here.)

Timeline for d1bx9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bx9a2