Lineage for d1bx9a1 (1bx9 A:86-210)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1089232Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1089233Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1089234Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 1089498Protein Class phi GST [81356] (3 species)
  7. 1089508Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [47635] (2 PDB entries)
  8. 1089511Domain d1bx9a1: 1bx9 A:86-210 [17729]
    Other proteins in same PDB: d1bx9a2

Details for d1bx9a1

PDB Entry: 1bx9 (more details), 2.6 Å

PDB Description: glutathione s-transferase in complex with herbicide
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1bx9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx9a1 a.45.1.1 (A:86-210) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}
qtdsknisqyaimaigmqvedhqfdpvasklafeqifksiyglttdeavvaeeeaklakv
ldvyearlkefkylagetftltdlhhipaiqyllgtptkklfterprvnewvaeitkrpa
sekvq

SCOPe Domain Coordinates for d1bx9a1:

Click to download the PDB-style file with coordinates for d1bx9a1.
(The format of our PDB-style files is described here.)

Timeline for d1bx9a1: