Lineage for d3h6io_ (3h6i O:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2995215Species Mycobacterium tuberculosis [TaxId:1773] [187707] (16 PDB entries)
  8. 2995260Domain d3h6io_: 3h6i O: [177272]
    automated match to d1q5qa_
    complexed with dmf

Details for d3h6io_

PDB Entry: 3h6i (more details), 2.43 Å

PDB Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome Modified by inhibitor GL1
PDB Compounds: (O:) Proteasome (Alpha subunit) PrcA

SCOPe Domain Sequences for d3h6io_:

Sequence, based on SEQRES records: (download)

>d3h6io_ d.153.1.4 (O:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
lragsadtsggdqptlgvaslevavldanrprrafrritgsalqall

Sequence, based on observed residues (ATOM records): (download)

>d3h6io_ d.153.1.4 (O:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
lraggvaslevavldanrprrafrritgsalqall

SCOPe Domain Coordinates for d3h6io_:

Click to download the PDB-style file with coordinates for d3h6io_.
(The format of our PDB-style files is described here.)

Timeline for d3h6io_: