SCOPe 2.04: Domain d3h6da1: 3h6d A:-10-133

Lineage for d3h6da1 (3h6d A:-10-133)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein automated matches [190798] (8 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189128] (5 PDB entries)

8. Domain d3h6da1: 3h6d A:-10-133 [177227]
   automated match to d1sixa_
   complexed with dup, mg, trs; mutant

Details for d3h6da1

PDB Entry: 3h6d, 1.8 Å

PDB Description: structure of the mycobacterium tuberculosis dutpase d28n mutant

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d3h6da1:

Sequence; same for both SEQRES and ATOM records:

>d3h6da1 b.85.4.1 (A:-10-133) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
hssglvprgshmsttlaivrldpglplpsrahdgdagvnlysaedvelapgrralvrtgv
avavpfgmvglvhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgd
riaqllvqrvelvelvevssfdea

Timeline for d3h6da1:

• d3h6da1 first appeared in SCOPe 2.01
  
• d3h6da1 appears in SCOPe 2.03
  
• d3h6da1 appears in SCOPe 2.05
  
• d3h6da1 appears in the current release, SCOPe 2.08