Lineage for d3h6da1 (3h6d A:1-133)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.85: beta-clip [51268] (7 superfamilies)
double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
Superfamily b.85.4: dUTPase-like [51283] (2 families) 
forms tight trimer through an additional beta-sheet in each subunit
subunit beta-sheets are orthogonally packed around the three-fold axis
Family b.85.4.1: dUTPase-like [51284] (5 proteins) 
Protein automated matches [190798] (9 species)
not a true proteinSpecies Mycobacterium tuberculosis [TaxId:1773] [189128] (6 PDB entries) 
Domain d3h6da1: 3h6d A:1-133 [177227]
Other proteins in same PDB: d3h6da2
automated match to d1sixa_
complexed with dup, mg, trs; mutant
Details for d3h6da1
PDB Entry: 3h6d (more details), 1.8 Å
PDB Description: structure of the mycobacterium tuberculosis dutpase d28n mutant
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolaseSCOPe Domain Sequences for d3h6da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h6da1 b.85.4.1 (A:1-133) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
msttlaivrldpglplpsrahdgdagvnlysaedvelapgrralvrtgvavavpfgmvgl
vhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrve
lvelvevssfdea
SCOPe Domain Coordinates for d3h6da1:
Click to download the PDB-style file with coordinates for d3h6da1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3h6da1:
- d3h6da1 first appeared in SCOPe 2.01
- d3h6da1 appears in SCOPe 2.07
View in 3D
