![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) |
![]() | Protein Serine/threonine protein phosphatase 5, PP5 [111231] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [111232] (10 PDB entries) Uniprot P53041 176-499 |
![]() | Domain d3h69a_: 3h69 A: [177223] automated match to d1s95a_ complexed with enl, zn |
PDB Entry: 3h69 (more details), 2.1 Å
SCOPe Domain Sequences for d3h69a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h69a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} ysgpkledgkvtisfmkelmqwykdqkklhrkcayqilvqvkevlsklstlvettlkete kitvcgdthgqfydllnifelnglpsetnpyifngdfvdrgsfsveviltlfgfkllypd hfhllrgnhetdnmnqiygfegevkakytaqmyelfsevfewlplaqcingkvlimhggl fsedgvtlddirkiernrqppdsgpmcdllwsdpqpqngrsiskrgvscqfgpdvtkafl eennldyiirshevkaegyevahggrcvtvfsapnycdqmgnkasyihlqgsdlrpqfhq ftavphpnvkpmaya
Timeline for d3h69a_: