Lineage for d3h63a_ (3h63 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679877Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1679878Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1679954Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1680021Protein Serine/threonine protein phosphatase 5, PP5 [111231] (1 species)
  7. 1680022Species Human (Homo sapiens) [TaxId:9606] [111232] (10 PDB entries)
    Uniprot P53041 176-499
  8. 1680023Domain d3h63a_: 3h63 A: [177213]
    automated match to d1s95a_
    complexed with mn, nhc

Details for d3h63a_

PDB Entry: 3h63 (more details), 1.3 Å

PDB Description: Catalytic domain of human Serine/Threonine Phosphatase 5 (PP5c) with two Mn2+ atoms originally soaked with cantharidin (which is present in the structure in the hydrolyzed form)
PDB Compounds: (A:) Serine/threonine-protein phosphatase 5

SCOPe Domain Sequences for d3h63a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h63a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]}
ysgpkledgkvtisfmkelmqwykdqkklhrkcayqilvqvkevlsklstlvettlkete
kitvcgdthgqfydllnifelnglpsetnpyifngdfvdrgsfsveviltlfgfkllypd
hfhllrgnhetdnmnqiygfegevkakytaqmyelfsevfewlplaqcingkvlimhggl
fsedgvtlddirkiernrqppdsgpmcdllwsdpqpqngrsiskrgvscqfgpdvtkafl
eennldyiirshevkaegyevahggrcvtvfsapnycdqmgnkasyihlqgsdlrpqfhq
ftavphpnvkpmaya

SCOPe Domain Coordinates for d3h63a_:

Click to download the PDB-style file with coordinates for d3h63a_.
(The format of our PDB-style files is described here.)

Timeline for d3h63a_: