Lineage for d3h60b_ (3h60 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679877Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1679878Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1679954Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1680045Protein automated matches [190344] (1 species)
    not a true protein
  7. 1680046Species Human (Homo sapiens) [TaxId:9606] [187171] (6 PDB entries)
  8. 1680052Domain d3h60b_: 3h60 B: [177208]
    automated match to d1s95a_
    complexed with mn

Details for d3h60b_

PDB Entry: 3h60 (more details), 2 Å

PDB Description: Catalytic domain of human Serine/Threonine Phosphatase 5 (PP5c)with two Mn2+ atoms
PDB Compounds: (B:) Serine/threonine-protein phosphatase 5

SCOPe Domain Sequences for d3h60b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h60b_ d.159.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ysgpkledgkvtisfmkelmqwykdqkklhrkcayqilvqvkevlsklstlvettlkete
kitvcgdthgqfydllnifelnglpsetnpyifngdfvdrgsfsveviltlfgfkllypd
hfhllrgnhetdnmnqiygfegevkakytaqmyelfsevfewlplaqcingkvlimhggl
fsedgvtlddirkiernrqppdsgpmcdllwsdpqpqngrsiskrgvscqfgpdvtkafl
eennldyiirshevkaegyevahggrcvtvfsapnycdqmgnkasyihlqgsdlrpqfhq
ftavphpnvkpmaya

SCOPe Domain Coordinates for d3h60b_:

Click to download the PDB-style file with coordinates for d3h60b_.
(The format of our PDB-style files is described here.)

Timeline for d3h60b_: