![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins) automatically mapped to Pfam PF12697 |
![]() | Protein automated matches [191073] (1 species) not a true protein |
![]() | Species Rauvolfia serpentina [TaxId:4060] [188982] (3 PDB entries) |
![]() | Domain d3gzjc_: 3gzj C: [177108] automated match to d1y7ha_ complexed with evs |
PDB Entry: 3gzj (more details), 2.19 Å
SCOPe Domain Sequences for d3gzjc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gzjc_ c.69.1.20 (C:) automated matches {Rauvolfia serpentina [TaxId: 4060]} qkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeihtfrdyseplm evmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhsltypfekyn ekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakmltrpgslff qdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeikeadamgmls qprevckclldisd
Timeline for d3gzjc_:
![]() Domains from other chains: (mouse over for more information) d3gzja_, d3gzjb_, d3gzjd_, d3gzje_ |