Lineage for d3gzjc_ (3gzj C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901127Family c.69.1.20: Hydroxynitrile lyase-like [53585] (3 proteins)
    automatically mapped to Pfam PF12697
  6. 2901196Protein automated matches [191073] (1 species)
    not a true protein
  7. 2901197Species Rauvolfia serpentina [TaxId:4060] [188982] (3 PDB entries)
  8. 2901207Domain d3gzjc_: 3gzj C: [177108]
    automated match to d1y7ha_
    complexed with evs

Details for d3gzjc_

PDB Entry: 3gzj (more details), 2.19 Å

PDB Description: crystal structure of polyneuridine aldehyde esterase complexed with 16-epi-vellosimine
PDB Compounds: (C:) Polyneuridine-aldehyde esterase

SCOPe Domain Sequences for d3gzjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gzjc_ c.69.1.20 (C:) automated matches {Rauvolfia serpentina [TaxId: 4060]}
qkhfvlvhggclgawiwyklkpllesaghkvtavdlsaaginprrldeihtfrdyseplm
evmasippdekvvllghsfggmslglametypekisvavfmsammpdpnhsltypfekyn
ekcpadmmldsqfstygnpenpgmsmilgpqfmalkmfqncsvedlelakmltrpgslff
qdlakakkfsterygsvkrayifcnedksfpvefqkwfvesvgadkvkeikeadamgmls
qprevckclldisd

SCOPe Domain Coordinates for d3gzjc_:

Click to download the PDB-style file with coordinates for d3gzjc_.
(The format of our PDB-style files is described here.)

Timeline for d3gzjc_: