Class a: All alpha proteins [46456] (286 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class theta GST [81350] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47629] (3 PDB entries) |
Domain d1ljra1: 1ljr A:80-244 [17707] Other proteins in same PDB: d1ljra2, d1ljrb2 complexed with gsh |
PDB Entry: 1ljr (more details), 3.2 Å
SCOPe Domain Sequences for d1ljra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpeekvernrtam dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea flgaelcqeahsiilsileqaakktlptpspeayqamllriarip
Timeline for d1ljra1: