SCOPe 2.05: Domain d1ljra1: 1ljr A:80-244

Lineage for d1ljra1 (1ljr A:80-244)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class theta GST [81350] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47629] (3 PDB entries)

8. Domain d1ljra1: 1ljr A:80-244 [17707]
   Other proteins in same PDB: d1ljra2, d1ljrb2
   complexed with gsh

Details for d1ljra1

PDB Entry: 1ljr, 3.2 Å

PDB Description: glutathione transferase (hgst t2-2) from human

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1ljra1:

Sequence; same for both SEQRES and ATOM records:

>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]}
tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpeekvernrtam
dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea
flgaelcqeahsiilsileqaakktlptpspeayqamllriarip

Timeline for d1ljra1:

• d1ljra1 first appeared (with stable ids) in SCOP 1.55
  
• d1ljra1 appears in SCOPe 2.04
  
• d1ljra1 appears in SCOPe 2.06
  
• d1ljra1 appears in the current release, SCOPe 2.08