Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (10 species) not a true protein |
Species Bacillus cereus [TaxId:222523] [188845] (1 PDB entry) |
Domain d3grdb_: 3grd B: [176934] automated match to d3ec9a1 complexed with act, na |
PDB Entry: 3grd (more details), 1.25 Å
SCOPe Domain Sequences for d3grdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3grdb_ d.17.4.0 (B:) automated matches {Bacillus cereus [TaxId: 222523]} pkanleiirstyegsassnakhlaealsekvewteaegfpyggtyigveaimenvfsrlg sewndykasvnmyhevsgkdviiaegmysgvykdtgksfeaefvhvwqlengkivkfkqy vdshlvreamks
Timeline for d3grdb_: