Lineage for d3grdb_ (3grd B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020659Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1020660Protein automated matches [190205] (10 species)
    not a true protein
  7. 1020661Species Bacillus cereus [TaxId:222523] [188845] (1 PDB entry)
  8. 1020663Domain d3grdb_: 3grd B: [176934]
    automated match to d3ec9a1
    complexed with act, na

Details for d3grdb_

PDB Entry: 3grd (more details), 1.25 Å

PDB Description: crystal structure of ntf2-superfamily protein with unknown function (np_977240.1) from bacillus cereus atcc 10987 at 1.25 a resolution
PDB Compounds: (B:) uncharacterized NTF2-superfamily protein

SCOPe Domain Sequences for d3grdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3grdb_ d.17.4.0 (B:) automated matches {Bacillus cereus [TaxId: 222523]}
pkanleiirstyegsassnakhlaealsekvewteaegfpyggtyigveaimenvfsrlg
sewndykasvnmyhevsgkdviiaegmysgvykdtgksfeaefvhvwqlengkivkfkqy
vdshlvreamks

SCOPe Domain Coordinates for d3grdb_:

Click to download the PDB-style file with coordinates for d3grdb_.
(The format of our PDB-style files is described here.)

Timeline for d3grdb_: