Lineage for d3ec9a1 (3ec9 A:10-139)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020475Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins)
  6. 1020486Protein Uncharacterized protein BTHI0051 [159973] (1 species)
  7. 1020487Species Burkholderia thailandensis [TaxId:57975] [159974] (1 PDB entry)
    Uniprot Q2T2I4 10-139
  8. 1020488Domain d3ec9a1: 3ec9 A:10-139 [158092]
    complexed with act, gol

Details for d3ec9a1

PDB Entry: 3ec9 (more details), 1.6 Å

PDB Description: crystal structure of a ntf2-like protein (bth_i0051) from burkholderia thailandensis e264 at 1.60 a resolution
PDB Compounds: (A:) uncharacterized NTF2-like protein

SCOPe Domain Sequences for d3ec9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]}
mrtpyqivadhyaasdrhdpaammadiapaiewtemagfpcagtyrsadeivrnvfrrlg
eewdgytfkldalhdagdtvigvgrysgtyrrtgksfecrvahvwrvdagkivhfeqftd
tllvaqamqp

SCOPe Domain Coordinates for d3ec9a1:

Click to download the PDB-style file with coordinates for d3ec9a1.
(The format of our PDB-style files is described here.)

Timeline for d3ec9a1: