Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (6 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (20 PDB entries) |
Domain d3gpwg_: 3gpw G: [176880] Other proteins in same PDB: d3gpw1_, d3gpw2_, d3gpwa_, d3gpwb_, d3gpwc_, d3gpwe_, d3gpwf_, d3gpwh_, d3gpwi_, d3gpwj_, d3gpwk_, d3gpwl_, d3gpwm_, d3gpwn_, d3gpwo_, d3gpwp_, d3gpwq_, d3gpws_, d3gpwt_, d3gpwv_, d3gpww_, d3gpwx_, d3gpwy_, d3gpwz_ automated match to d1g65g_ complexed with sa1 |
PDB Entry: 3gpw (more details), 2.5 Å
SCOPe Domain Sequences for d3gpwg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gpwg_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia eqd
Timeline for d3gpwg_: