SCOPe 2.08: Domain d3gp6a1: 3gp6 A:0-161

Lineage for d3gp6a1 (3gp6 A:0-161)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.1: OMPA-like [56925] (5 families)
   forms (8,10) barrel

5. Family f.4.1.2: Outer membrane enzyme PagP [82874] (2 proteins)
   automatically mapped to Pfam PF07017

6. Protein automated matches [191163] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189370] (1 PDB entry)

8. Domain d3gp6a1: 3gp6 A:0-161 [176803]
   Other proteins in same PDB: d3gp6a2
   automated match to d1mm4a_
   complexed with li, mpd, mrd, sds, so4

Details for d3gp6a1

PDB Entry: 3gp6, 1.4 Å

PDB Description: Crystal structure of PagP in SDS/MPD

PDB Compounds: (A:) Protein pagP

SCOPe Domain Sequences for d3gp6a1:

Sequence, based on SEQRES records:

>d3gp6a1 f.4.1.2 (A:0-161) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mnadewmttfreniaqtwqqpehydlyipaitwharfaydkektdrynerpwgggfglsr
wdekgnwhglyamafkdswnkwepiagygwestwrpladenfhlglgftagvtardnwny
iplpvllplasvgygpvtfqmtyipgtynngnvyfawmrfqf

Sequence, based on observed residues (ATOM records):

>d3gp6a1 f.4.1.2 (A:0-161) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mnadewmttfreniaqtwqqpehydlyipaitwharfaynerpwgggfglsrwdekgnwh
glyamafkdswnkwepiagygwestwrpladenfhlglgftagvtardnwnyiplpvllp
lasvgygpvtfqmtyipgtynngnvyfawmrfqf

Timeline for d3gp6a1:

• d3gp6a1 first appeared in SCOPe 2.01, called d3gp6a_
  
• d3gp6a1 appears in SCOPe 2.07