Lineage for d3govb_ (3gov B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1795550Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 1795551Protein automated matches [190438] (20 species)
    not a true protein
  7. 1795573Species Human (Homo sapiens) [TaxId:9606] [187421] (52 PDB entries)
  8. 1795606Domain d3govb_: 3gov B: [176794]
    automated match to d1tgsz_
    complexed with gol

Details for d3govb_

PDB Entry: 3gov (more details), 2.55 Å

PDB Description: Crystal structure of the catalytic region of human MASP-1
PDB Compounds: (B:) masp-1

SCOPe Domain Sequences for d3govb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3govb_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifngrpaqkgttpwiamlshlngqpfcggsllgsswivtaahclhqsldpkdptlrdsdl
lspsdfkiilgkhwrlrsdeneqhlgvkhttlhpqydpntfendvalvellespvlnafv
mpiclpegpqqegamvivsgwgkqflqrfpetlmeieipivdhstcqkayaplkkkvtrd
micagekeggkdacagdsggpmvtlnrergqwylvgtvswgddcgkkdrygvysyihhnk
dwiqrvtgvrn

SCOPe Domain Coordinates for d3govb_:

Click to download the PDB-style file with coordinates for d3govb_.
(The format of our PDB-style files is described here.)

Timeline for d3govb_: