SCOPe 2.01: Domain d3govb_: 3gov B:

Lineage for d3govb_ (3gov B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187421] (15 PDB entries)

8. Domain d3govb_: 3gov B: [176794]
   automated match to d1tgsz_
   complexed with gol

Details for d3govb_

PDB Entry: 3gov, 2.55 Å

PDB Description: Crystal structure of the catalytic region of human MASP-1

PDB Compounds: (B:) masp-1

SCOPe Domain Sequences for d3govb_:

Sequence; same for both SEQRES and ATOM records:

>d3govb_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifngrpaqkgttpwiamlshlngqpfcggsllgsswivtaahclhqsldpkdptlrdsdl
lspsdfkiilgkhwrlrsdeneqhlgvkhttlhpqydpntfendvalvellespvlnafv
mpiclpegpqqegamvivsgwgkqflqrfpetlmeieipivdhstcqkayaplkkkvtrd
micagekeggkdacagdsggpmvtlnrergqwylvgtvswgddcgkkdrygvysyihhnk
dwiqrvtgvrn

Timeline for d3govb_:

• d3govb_ is new in SCOPe 2.01-stable
  
• d3govb_ appears in SCOPe 2.02
  
• d3govb_ appears in the current release, SCOPe 2.08