Lineage for d3gmxa_ (3gmx A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663250Fold d.98: BLIP-like [55647] (2 superfamilies)
    alpha(2)-beta(4); 2 layers: alpha/beta
  4. 1663251Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families) (S)
  5. 1663279Family d.98.1.0: automated matches [191579] (1 protein)
    not a true family
  6. 1663280Protein automated matches [191029] (2 species)
    not a true protein
  7. 1663281Species Streptomyces clavuligerus [TaxId:1901] [188840] (2 PDB entries)
  8. 1663282Domain d3gmxa_: 3gmx A: [176762]
    automated match to d1s0wc_
    complexed with act

Details for d3gmxa_

PDB Entry: 3gmx (more details), 1.05 Å

PDB Description: crystal structure of beta-lactamse inhibitory protein-like protein (blp) at 1.05 angstrom resolution
PDB Compounds: (A:) blp

SCOPe Domain Sequences for d3gmxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gmxa_ d.98.1.0 (A:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
ytgftperynkiqfgmdrtlvwqlagadqscsdqveriicynnpdhygpqghfffnaadk
lihkrqmelfpapkptmrlatynktqtgmteaqfwaavpsdtcsalaeqypnwpatngnl
reyvcpskaerfapsayftftdgkltsrsqsqlp

SCOPe Domain Coordinates for d3gmxa_:

Click to download the PDB-style file with coordinates for d3gmxa_.
(The format of our PDB-style files is described here.)

Timeline for d3gmxa_: