| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.98: BLIP-like [55647] (2 superfamilies) alpha(2)-beta(4); 2 layers: alpha/beta |
Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families) ![]() |
| Family d.98.1.0: automated matches [191579] (1 protein) not a true family |
| Protein automated matches [191029] (2 species) not a true protein |
| Species Streptomyces clavuligerus [TaxId:1901] [188840] (2 PDB entries) |
| Domain d3gmxa_: 3gmx A: [176762] automated match to d1s0wc_ complexed with act |
PDB Entry: 3gmx (more details), 1.05 Å
SCOPe Domain Sequences for d3gmxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gmxa_ d.98.1.0 (A:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
ytgftperynkiqfgmdrtlvwqlagadqscsdqveriicynnpdhygpqghfffnaadk
lihkrqmelfpapkptmrlatynktqtgmteaqfwaavpsdtcsalaeqypnwpatngnl
reyvcpskaerfapsayftftdgkltsrsqsqlp
Timeline for d3gmxa_: