SCOPe 2.08: Domain d3gmxa_: 3gmx A:

Lineage for d3gmxa_ (3gmx A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.98: BLIP-like [55647] (2 superfamilies)
   alpha(2)-beta(4); 2 layers: alpha/beta

4. Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families)

5. Family d.98.1.0: automated matches [191579] (1 protein)
   not a true family

6. Protein automated matches [191029] (2 species)
   not a true protein

7. Species Streptomyces clavuligerus [TaxId:1901] [188840] (2 PDB entries)

8. Domain d3gmxa_: 3gmx A: [176762]
   automated match to d1s0wc_
   complexed with act

Details for d3gmxa_

PDB Entry: 3gmx, 1.05 Å

PDB Description: crystal structure of beta-lactamse inhibitory protein-like protein (blp) at 1.05 angstrom resolution

PDB Compounds: (A:) blp

SCOPe Domain Sequences for d3gmxa_:

Sequence; same for both SEQRES and ATOM records:

>d3gmxa_ d.98.1.0 (A:) automated matches {Streptomyces clavuligerus [TaxId: 1901]}
ytgftperynkiqfgmdrtlvwqlagadqscsdqveriicynnpdhygpqghfffnaadk
lihkrqmelfpapkptmrlatynktqtgmteaqfwaavpsdtcsalaeqypnwpatngnl
reyvcpskaerfapsayftftdgkltsrsqsqlp

Timeline for d3gmxa_:

• d3gmxa_ first appeared in SCOPe 2.01
  
• d3gmxa_ appears in SCOPe 2.07