SCOPe 2.05: Domain d3gk9a_: 3gk9 A:

Lineage for d3gk9a_ (3gk9 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Neuroglobin [100978] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109625] (12 PDB entries)
   Uniprot Q9ER97

8. Domain d3gk9a_: 3gk9 A: [176718]
   automated match to d1q1fa_
   complexed with hem, so4, xe

Details for d3gk9a_

PDB Entry: 3gk9, 1.8 Å

PDB Description: crystal structure of murine ngb under xe pressure

PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d3gk9a_:

Sequence; same for both SEQRES and ATOM records:

>d3gk9a_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwdg

Timeline for d3gk9a_:

• d3gk9a_ first appeared in SCOPe 2.01
  
• d3gk9a_ appears in SCOPe 2.04
  
• d3gk9a_ appears in SCOPe 2.06
  
• d3gk9a_ appears in the current release, SCOPe 2.08