SCOPe 2.01: Domain d1gsub1: 1gsu B:85-217

Lineage for d1gsub1 (1gsu B:85-217)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47624] (2 PDB entries)

8. Domain d1gsub1: 1gsu B:85-217 [17662]
   Other proteins in same PDB: d1gsua2, d1gsub2
   complexed with gtx

Details for d1gsub1

PDB Entry: 1gsu, 1.94 Å

PDB Description: an avian class-mu glutathione s-transferase, cgstm1-1 at 1.94 angstrom resolution

PDB Compounds: (B:) class-mu glutathione s-transferase

SCOPe Domain Sequences for d1gsub1:

Sequence; same for both SEQRES and ATOM records:

>d1gsub1 a.45.1.1 (B:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]}
mcgetevekqrvdvlenhlmdlrmafarlcyspdfeklkpayleqlpgklrqlsrflgsr
swfvgdkltfvdflaydvldqqrmfvpdcpelqgnlsqflqrfealekisaymrsgrfmk
apifwytalwnnk

Timeline for d1gsub1:

• d1gsub1 first appeared (with stable ids) in SCOP 1.55
  
• d1gsub1 appears in SCOP 1.75
  
• d1gsub1 appears in SCOPe 2.02
  
• d1gsub1 appears in the current release, SCOPe 2.08