Lineage for d1gsub1 (1gsu B:85-217)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915607Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 915608Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 915609Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 915772Protein Class mu GST [81348] (3 species)
  7. 915773Species Chicken (Gallus gallus) [TaxId:9031] [47624] (2 PDB entries)
  8. 915775Domain d1gsub1: 1gsu B:85-217 [17662]
    Other proteins in same PDB: d1gsua2, d1gsub2
    complexed with gtx

Details for d1gsub1

PDB Entry: 1gsu (more details), 1.94 Å

PDB Description: an avian class-mu glutathione s-transferase, cgstm1-1 at 1.94 angstrom resolution
PDB Compounds: (B:) class-mu glutathione s-transferase

SCOPe Domain Sequences for d1gsub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsub1 a.45.1.1 (B:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]}
mcgetevekqrvdvlenhlmdlrmafarlcyspdfeklkpayleqlpgklrqlsrflgsr
swfvgdkltfvdflaydvldqqrmfvpdcpelqgnlsqflqrfealekisaymrsgrfmk
apifwytalwnnk

SCOPe Domain Coordinates for d1gsub1:

Click to download the PDB-style file with coordinates for d1gsub1.
(The format of our PDB-style files is described here.)

Timeline for d1gsub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsub2