Lineage for d3gg3a_ (3gg3 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2319939Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2320004Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species)
  7. 2320005Species Human (Homo sapiens) [TaxId:9606] [47376] (8 PDB entries)
  8. 2320006Domain d3gg3a_: 3gg3 A: [176610]
    automated match to d1jm4b_
    complexed with cl

Details for d3gg3a_

PDB Entry: 3gg3 (more details), 2.25 Å

PDB Description: crystal structure of the bromodomain of human pcaf
PDB Compounds: (A:) Histone acetyltransferase PCAF

SCOPe Domain Sequences for d3gg3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gg3a_ a.29.2.1 (A:) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
pdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlknryyvs
kklfmadlqrvftnckeynppeseyykcanilekfffskikeaglid

SCOPe Domain Coordinates for d3gg3a_:

Click to download the PDB-style file with coordinates for d3gg3a_.
(The format of our PDB-style files is described here.)

Timeline for d3gg3a_: