SCOPe 2.08: Domain d3gg3a_: 3gg3 A:

Lineage for d3gg3a_ (3gg3 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47376] (8 PDB entries)

8. Domain d3gg3a_: 3gg3 A: [176610]
   automated match to d1jm4b_
   complexed with cl

Details for d3gg3a_

PDB Entry: 3gg3, 2.25 Å

PDB Description: crystal structure of the bromodomain of human pcaf

PDB Compounds: (A:) Histone acetyltransferase PCAF

SCOPe Domain Sequences for d3gg3a_:

Sequence; same for both SEQRES and ATOM records:

>d3gg3a_ a.29.2.1 (A:) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
pdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktmserlknryyvs
kklfmadlqrvftnckeynppeseyykcanilekfffskikeaglid

Timeline for d3gg3a_:

• d3gg3a_ first appeared in SCOPe 2.01
  
• d3gg3a_ appears in SCOPe 2.07