Lineage for d1gsbc1 (1gsb C:85-217)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915607Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 915608Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 915609Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 915772Protein Class mu GST [81348] (3 species)
  7. 915834Species Norway rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)
  8. 915863Domain d1gsbc1: 1gsb C:85-217 [17655]
    Other proteins in same PDB: d1gsba2, d1gsbb2, d1gsbc2, d1gsbd2
    CA-atoms only

Details for d1gsbc1

PDB Entry: 1gsb (more details), 2.5 Å

PDB Description: new crystal forms of a mu class glutathione s-transferase from rat liver
PDB Compounds: (C:) glutathione s-transferase

SCOPe Domain Sequences for d1gsbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsbc1 a.45.1.1 (C:85-217) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

SCOPe Domain Coordinates for d1gsbc1:

Click to download the PDB-style file with coordinates for d1gsbc1.
(The format of our PDB-style files is described here.)

Timeline for d1gsbc1: