| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
| Protein Class mu GST [81348] (3 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries) |
| Domain d3fyga1: 3fyg A:85-217 [17651] Other proteins in same PDB: d3fyga2, d3fygb2 complexed with gpr |
PDB Entry: 3fyg (more details), 2.2 Å
SCOPe Domain Sequences for d3fyga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fyga1 a.45.1.1 (A:85-217) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk
Timeline for d3fyga1: