SCOPe 2.07: Domain d3gboa_: 3gbo A:

Lineage for d3gboa_ (3gbo A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
   Pfam PF01421

6. Protein automated matches [190837] (3 species)
   not a true protein

7. Species Bothrops moojeni [TaxId:98334] [189045] (2 PDB entries)

8. Domain d3gboa_: 3gbo A: [176505]
   automated match to d1nd1a_
   complexed with ca, zn

Details for d3gboa_

PDB Entry: 3gbo, 1.77 Å

PDB Description: Crystal structure of BmooMPalpha-I, a non-hemorrhagic metalloproteinase isolated from Bothrops moojeni snake venom

PDB Compounds: (A:) Zinc metalloproteinase BmooMPalfa-I

SCOPe Domain Sequences for d3gboa_:

Sequence; same for both SEQRES and ATOM records:

>d3gboa_ d.92.1.9 (A:) automated matches {Bothrops moojeni [TaxId: 98334]}
fsprhielvvvadhgmfkkynsnlntirkwvhemvnsmngfyrsvdvtaslanlevwskk
dlinvqkdsretlksfgewrerdllprishdnaqllttivfdghvigraftggmcdprhs
vgvvmdhspknlqvavtmahelghnlgmhhdgnqchcdaascimadslsqvlsyefsdcs
qnqyqtyltkhnpqcilnep

Timeline for d3gboa_:

• d3gboa_ first appeared in SCOPe 2.01
  
• d3gboa_ appears in SCOPe 2.06
  
• d3gboa_ appears in the current release, SCOPe 2.08