Lineage for d3gaqb_ (3gaq B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551687Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1551688Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1551689Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1552080Protein automated matches [190163] (13 species)
    not a true protein
  7. 1552084Species Brown ear tick (Rhipicephalus appendiculatus) [TaxId:34631] [189209] (2 PDB entries)
  8. 1552088Domain d3gaqb_: 3gaq B: [176484]
    automated match to d1qfta_
    mutant

Details for d3gaqb_

PDB Entry: 3gaq (more details), 2.25 Å

PDB Description: female-specific histamine-binding protein, d24r mutant
PDB Compounds: (B:) Female-specific histamine-binding protein 2

SCOPe Domain Sequences for d3gaqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gaqb_ b.60.1.1 (B:) automated matches {Brown ear tick (Rhipicephalus appendiculatus) [TaxId: 34631]}
anqpdwadeaangahqdawkslkarvenvyymvkatykndpvwgndftcvgvmandvned
eksiqaeflfmnnadtnmqfatekvtavkmygynrenafryetedgqvftdviaysddnc
dviyvpgtdgneegyelwttdydnipanclnkfneyavgretrdvftsacle

SCOPe Domain Coordinates for d3gaqb_:

Click to download the PDB-style file with coordinates for d3gaqb_.
(The format of our PDB-style files is described here.)

Timeline for d3gaqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3gaqa_