Lineage for d1qfta_ (1qft A:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily)
barrel, closed or opened; n=8, S=12; meanderSuperfamily b.60.1: Lipocalins [50814] (10 families) 
bind hydrophobic ligands in their interiorFamily b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
barrel, closed; n=8, S=12, meander
Protein Histamine binding protein [50839] (1 species) Species Brown ear tick (Rhipicephalus appendiculatus) [TaxId:34631] [50840] (2 PDB entries) 
Domain d1qfta_: 1qft A: [27151]
complexed with hsm
Details for d1qfta_
PDB Entry: 1qft (more details), 1.25 Å
PDB Description: histamine binding protein from female brown ear rhipicephalus appendiculatus
PDB Compounds: (A:) protein (female-specific histamine binding protein 2)SCOPe Domain Sequences for d1qfta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qfta_ b.60.1.1 (A:) Histamine binding protein {Brown ear tick (Rhipicephalus appendiculatus) [TaxId: 34631]}
nqpdwadeaangahqdawkslkadvenvyymvkatykndpvwgndftcvgvmandvnede
ksiqaeflfmnnadtnmqfatekvtavkmygynrenafryetedgqvftdviaysddncd
viyvpgtdgneegyelwttdydnipanclnkfneyavgretrdvftsacleiaaa
SCOPe Domain Coordinates for d1qfta_:
Click to download the PDB-style file with coordinates for d1qfta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qfta_:
- d1qfta_ first appeared (with stable ids) in SCOP 1.55
- d1qfta_ appears in SCOPe 2.03
- d1qfta_ appears in SCOPe 2.05
- d1qfta_ appears in the current release, SCOPe 2.08
View in 3D
