SCOPe 2.04: Domain d3g7xb_: 3g7x B:

Lineage for d3g7xb_ (3g7x B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (13 species)
   not a true protein

7. Species Brown ear tick (Rhipicephalus appendiculatus) [TaxId:34631] [189209] (2 PDB entries)

8. Domain d3g7xb_: 3g7x B: [176411]
   automated match to d1qfta_
   complexed with gol, hsm; mutant

Details for d3g7xb_

PDB Entry: 3g7x, 1.55 Å

PDB Description: female-specific histamine-binding protein 2, d24r mutant

PDB Compounds: (B:) Female-specific histamine-binding protein 2

SCOPe Domain Sequences for d3g7xb_:

Sequence; same for both SEQRES and ATOM records:

>d3g7xb_ b.60.1.1 (B:) automated matches {Brown ear tick (Rhipicephalus appendiculatus) [TaxId: 34631]}
qpdwadeaangahqdawkslkarvenvyymvkatykndpvwgndftcvgvmandvnedek
siqaeflfmnnadtnmqfatekvtavkmygynrenafryetedgqvftdviaysddncdv
iyvpgtdgneegyelwttdydnipanclnkfneyavgretrdvftsacle

Timeline for d3g7xb_:

• d3g7xb_ first appeared in SCOPe 2.01
  
• d3g7xb_ appears in SCOPe 2.03
  
• d3g7xb_ appears in SCOPe 2.05
  
• d3g7xb_ appears in the current release, SCOPe 2.08