| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily) complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354 |
Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family) ![]() |
| Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins) |
| Protein automated matches [191028] (2 species) not a true protein |
| Species Thermotoga maritima [TaxId:243274] [188837] (1 PDB entry) |
| Domain d3g4ab_: 3g4a B: [176343] automated match to d1kq4b_ complexed with fad, ump; mutant |
PDB Entry: 3g4a (more details), 1.95 Å
SCOPe Domain Sequences for d3g4ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g4ab_ d.207.1.1 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
hmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfeh
ivftfhvkapifvarqwfrhriasynelagrysklsyefyipsperlegykttippervt
ekiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradsha
qweiqqyalaiarifkekcpwtfeaflkyaykgdilkevq
Timeline for d3g4ab_: