SCOPe 2.08: Domain d3g4ab1: 3g4a B:1-219

Lineage for d3g4ab1 (3g4a B:1-219)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
   complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354

4. Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (2 families)
   automatically mapped to Pfam PF02511

5. Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)

6. Protein automated matches [191028] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [188837] (1 PDB entry)

8. Domain d3g4ab1: 3g4a B:1-219 [176343]
   Other proteins in same PDB: d3g4aa2, d3g4ab2
   automated match to d1kq4b_
   complexed with fad, ump; mutant

Details for d3g4ab1

PDB Entry: 3g4a, 1.95 Å

PDB Description: crystal structure of flavine dependant thymidylate synthase s88a mutant from thermotoga maritima at 1.95 angstrom resolution

PDB Compounds: (B:) Thymidylate synthase thyX

SCOPe Domain Sequences for d3g4ab1:

Sequence; same for both SEQRES and ATOM records:

>d3g4ab1 d.207.1.1 (B:1-219) automated matches {Thermotoga maritima [TaxId: 243274]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelagrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilkevq

Timeline for d3g4ab1:

• d3g4ab1 first appeared in SCOPe 2.01, called d3g4ab_
  
• d3g4ab1 appears in SCOPe 2.07