Lineage for d3g2ya_ (3g2y A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1054405Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1054945Protein automated matches [190161] (13 species)
    not a true protein
  7. 1054971Species Escherichia coli [TaxId:562] [187306] (27 PDB entries)
  8. 1054985Domain d3g2ya_: 3g2y A: [176314]
    automated match to d1iyqa_
    complexed with dms, gf4

Details for d3g2ya_

PDB Entry: 3g2y (more details), 1.31 Å

PDB Description: ctx-m-9 class a beta-lactamase complexed with compound 1 (gf4)
PDB Compounds: (A:) Beta-lactamase CTX-M-9a

SCOPe Domain Sequences for d3g2ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g2ya_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
etsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqse
tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
qlvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftq
pqqnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d3g2ya_:

Click to download the PDB-style file with coordinates for d3g2ya_.
(The format of our PDB-style files is described here.)

Timeline for d3g2ya_: