Lineage for d4gtuc1 (4gtu C:85-217)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915607Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 915608Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 915609Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 915772Protein Class mu GST [81348] (3 species)
  7. 915780Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries)
    Uniprot P09488 P28161
  8. 915828Domain d4gtuc1: 4gtu C:85-217 [17623]
    Other proteins in same PDB: d4gtua2, d4gtub2, d4gtuc2, d4gtud2, d4gtue2, d4gtuf2, d4gtug2, d4gtuh2

Details for d4gtuc1

PDB Entry: 4gtu (more details), 3.3 Å

PDB Description: ligand-free homodimeric human glutathione s-transferase m4-4
PDB Compounds: (C:) glutathione s-transferase

SCOPe Domain Sequences for d4gtuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gtuc1 a.45.1.1 (C:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqamdvsnqlarvcyspdfeklkpeyleelptmmqhfsqflgkr
pwfvgdkitfvdflaydvldlhrifepncldafpnlkdfisrfeglekisaymkssrflp
kplytrvavwgnk

SCOPe Domain Coordinates for d4gtuc1:

Click to download the PDB-style file with coordinates for d4gtuc1.
(The format of our PDB-style files is described here.)

Timeline for d4gtuc1: