Lineage for d3fz2e1 (3fz2 E:4-134)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616732Fold d.323: Phage tail protein-like [143748] (1 superfamily)
    alpha-beta-X-beta(2)-alpha-beta(2); 2 layers: a/b; mixed beta-sheet: order 12354, strands 1 and 2 are parallel
  4. 2616733Superfamily d.323.1: Phage tail protein-like [143749] (2 families) (S)
    Can form ring, tube-like oligomers, where the subunit beta-sheets are joined in a single beta-sheet (or barrel)
  5. 2616734Family d.323.1.1: Lambda phage gpU-like [143750] (2 proteins)
    Pfam PF06141
  6. 2616738Protein automated matches [191050] (1 species)
    not a true protein
  7. 2616739Species Enterobacteria phage [TaxId:10710] [188903] (2 PDB entries)
  8. 2616744Domain d3fz2e1: 3fz2 E:4-134 [176176]
    Other proteins in same PDB: d3fz2a2, d3fz2b2, d3fz2d2, d3fz2e2, d3fz2f2, d3fz2g2, d3fz2h2, d3fz2j2, d3fz2k2, d3fz2l2
    automated match to d1z1za1
    complexed with so4

Details for d3fz2e1

PDB Entry: 3fz2 (more details), 2.7 Å

PDB Description: crystal structure of the tail terminator protein from phage lambda (gpu-d74a)
PDB Compounds: (E:) Minor tail protein U

SCOPe Domain Sequences for d3fz2e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fz2e1 d.323.1.1 (E:4-134) automated matches {Enterobacteria phage [TaxId: 10710]}
mkhtelraavldalekhdtgatffdgrpavfdeadfpavavyltgaeytgeeldsdtwqa
elhievflpaqvpaseldawmesriypvmsdipalsdlitsmvasgydyrrdddaglwss
adltyvityem

SCOPe Domain Coordinates for d3fz2e1:

Click to download the PDB-style file with coordinates for d3fz2e1.
(The format of our PDB-style files is described here.)

Timeline for d3fz2e1: