Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.323: Phage tail protein-like [143748] (1 superfamily) alpha-beta-X-beta(2)-alpha-beta(2); 2 layers: a/b; mixed beta-sheet: order 12354, strands 1 and 2 are parallel |
Superfamily d.323.1: Phage tail protein-like [143749] (2 families) Can form ring, tube-like oligomers, where the subunit beta-sheets are joined in a single beta-sheet (or barrel) |
Family d.323.1.1: Lambda phage gpU-like [143750] (2 proteins) Pfam PF06141 |
Protein Minor tail protein gpU [143751] (1 species) |
Species Bacteriophage lambda [TaxId:10710] [143752] (1 PDB entry) Uniprot P03732 2-130 |
Domain d1z1za1: 1z1z A:2-130 [124366] |
PDB Entry: 1z1z (more details)
SCOPe Domain Sequences for d1z1za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z1za1 d.323.1.1 (A:2-130) Minor tail protein gpU {Bacteriophage lambda [TaxId: 10710]} khtelraavldalekhdtgatffdgrpavfdeadfpavavyltgaeytgeeldsdtwqae lhievflpaqvpdseldawmesriypvmsdipalsdlitsmvasgydyrrdddaglwssa dltyvitye
Timeline for d1z1za1: