Lineage for d1hncb1 (1hnc B:85-217)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 538429Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 538430Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 538431Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 538565Protein Class mu GST [81348] (3 species)
  7. 538573Species Human (Homo sapiens) [TaxId:9606] [47622] (10 PDB entries)
  8. 538595Domain d1hncb1: 1hnc B:85-217 [17616]
    Other proteins in same PDB: d1hnca2, d1hncb2, d1hncc2, d1hncd2

Details for d1hncb1

PDB Entry: 1hnc (more details), 3 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity

SCOP Domain Sequences for d1hncb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hncb1 a.45.1.1 (B:85-217) Class mu GST {Human (Homo sapiens)}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavfgnk

SCOP Domain Coordinates for d1hncb1:

Click to download the PDB-style file with coordinates for d1hncb1.
(The format of our PDB-style files is described here.)

Timeline for d1hncb1: