Class a: All alpha proteins [46456] (226 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins) |
Protein Class mu GST [81348] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [47622] (10 PDB entries) |
Domain d1hncd1: 1hnc D:85-217 [17618] Other proteins in same PDB: d1hnca2, d1hncb2, d1hncc2, d1hncd2 complexed with gdn; mutant |
PDB Entry: 1hnc (more details), 3 Å
SCOP Domain Sequences for d1hncd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hncd1 a.45.1.1 (D:85-217) Class mu GST {Human (Homo sapiens)} lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp rpvftkmavfgnk
Timeline for d1hncd1: