SCOP 1.71: Domain d1hncd1: 1hnc D:85-217

Lineage for d1hncd1 (1hnc D:85-217)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47622] (10 PDB entries)

8. Domain d1hncd1: 1hnc D:85-217 [17618]
   Other proteins in same PDB: d1hnca2, d1hncb2, d1hncc2, d1hncd2
   complexed with gdn; mutant

Details for d1hncd1

PDB Entry: 1hnc, 3 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity

SCOP Domain Sequences for d1hncd1:

Sequence; same for both SEQRES and ATOM records:

>d1hncd1 a.45.1.1 (D:85-217) Class mu GST {Human (Homo sapiens)}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavfgnk

Timeline for d1hncd1:

• d1hncd1 first appeared (with stable ids) in SCOP 1.55
  
• d1hncd1 appears in SCOP 1.69
  
• d1hncd1 appears in SCOP 1.73
  
• d1hncd1 appears in the current release, SCOPe 2.08