SCOP 1.71: Domain d1hncb2: 1hnc B:1-84

Lineage for d1hncb2 (1hnc B:1-84)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (16 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class mu GST [81359] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52867] (10 PDB entries)

8. Domain d1hncb2: 1hnc B:1-84 [32910]
   Other proteins in same PDB: d1hnca1, d1hncb1, d1hncc1, d1hncd1

Details for d1hncb2

PDB Entry: 1hnc, 3 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity

SCOP Domain Sequences for d1hncb2:

Sequence; same for both SEQRES and ATOM records:

>d1hncb2 c.47.1.5 (B:1-84) Class mu GST {Human (Homo sapiens)}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

Timeline for d1hncb2:

• d1hncb2 first appeared (with stable ids) in SCOP 1.55
  
• d1hncb2 appears in SCOP 1.69
  
• d1hncb2 appears in SCOP 1.73
  
• d1hncb2 appears in the current release, SCOPe 2.08