SCOPe 2.02: Domain d3fy5b_: 3fy5 B:

Lineage for d3fy5b_ (3fy5 B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [187076] (1 PDB entry)

8. Domain d3fy5b_: 3fy5 B: [176134]
   automated match to d1l6oa_

Details for d3fy5b_

PDB Entry: 3fy5, 2.4 Å

PDB Description: Dishevelled PDZ domain homodimer

PDB Compounds: (B:) Segment polarity protein dishevelled homolog DVL-2

SCOPe Domain Sequences for d3fy5b_:

Sequence, based on SEQRES records:

>d3fy5b_ b.36.1.1 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
mtvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndinf
enmsnddavrvlrdivhkpgpivltvakc

Sequence, based on observed residues (ATOM records):

>d3fy5b_ b.36.1.1 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
mtvtlnmekynflgisivgqsnggiyigsimkggavaadgriepgdmllqvndinfenms
nddavrvlrdivhkpgpivltvakc

Timeline for d3fy5b_:

• d3fy5b_ first appeared in SCOPe 2.01
  
• d3fy5b_ appears in SCOPe 2.03
  
• d3fy5b_ appears in the current release, SCOPe 2.08