SCOPe 2.04: Domain d3fsda_: 3fsd A:

Lineage for d3fsda_ (3fsd A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (19 species)
   not a true protein

7. Species Rhodospirillum rubrum [TaxId:269796] [188772] (1 PDB entry)

8. Domain d3fsda_: 3fsd A: [176024]
   automated match to d2r4ic1
   complexed with edo, unl

Details for d3fsda_

PDB Entry: 3fsd, 1.7 Å

PDB Description: crystal structure of ntf2-like protein of unknown function in nutrient uptake (yp_427473.1) from rhodospirillum rubrum atcc 11170 at 1.70 a resolution

PDB Compounds: (A:) NTF2-like protein of unknown function in nutrient uptake

SCOPe Domain Sequences for d3fsda_:

Sequence; same for both SEQRES and ATOM records:

>d3fsda_ d.17.4.0 (A:) automated matches {Rhodospirillum rubrum [TaxId: 269796]}
ddiafyeerlraamltgdlkgletlladdlafvdhtgcvktkqthlepyragllklsrld
lsdavvraagedgrvvvvravtagvydgeaftetlrftriwrrtqgpagwklvaghcsvi
l

Timeline for d3fsda_:

• d3fsda_ first appeared in SCOPe 2.01
  
• d3fsda_ appears in SCOPe 2.03
  
• d3fsda_ appears in SCOPe 2.05
  
• d3fsda_ appears in the current release, SCOPe 2.08