Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (35 species) not a true protein |
Species Rhodospirillum rubrum [TaxId:269796] [188772] (1 PDB entry) |
Domain d3fsda_: 3fsd A: [176024] automated match to d2r4ic1 complexed with edo, unl |
PDB Entry: 3fsd (more details), 1.7 Å
SCOPe Domain Sequences for d3fsda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fsda_ d.17.4.0 (A:) automated matches {Rhodospirillum rubrum [TaxId: 269796]} ddiafyeerlraamltgdlkgletlladdlafvdhtgcvktkqthlepyragllklsrld lsdavvraagedgrvvvvravtagvydgeaftetlrftriwrrtqgpagwklvaghcsvi l
Timeline for d3fsda_: